PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_14764.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 322aa    MW: 35409.3 Da    PI: 9.0058
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_14764.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10181239563
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              kr++r   NR +A rs +RK +++ eLe+kv++L++e ++L  ++ +l+   + l++e+
  Rsa1.0_14764.1_g00001.1 181 KRAKRILANRQSAARSKERKIKYTGELERKVQTLQNEATTLSAQVTMLQRGTSDLTTEN 239
                              9*********************************************9999888888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.5E-15177241IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.588179242IPR004827Basic-leucine zipper domain
PfamPF001709.5E-9181239IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11181231No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-10181236No hitNo description
CDDcd147031.41E-21182230No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007231Biological Processosmosensory signaling pathway
GO:0008272Biological Processsulfate transport
GO:0009294Biological ProcessDNA mediated transformation
GO:0009652Biological Processthigmotropism
GO:0009970Biological Processcellular response to sulfate starvation
GO:0045596Biological Processnegative regulation of cell differentiation
GO:0051170Biological Processnuclear import
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
GO:0051019Molecular Functionmitogen-activated protein kinase binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MEPSQRPNQS SSILSEIERM PEAPRQRISH HRRARSDTFF SAGESIDDLL IFDPSDVDFS  60
SLDFLNAPPT PQPQPMSVDS PPEETSSNGA PPPPIPLPPG RHVRSFSVDS ESNFFDDLVA  120
EDTQLARSGG RKGGHHHRSN SMDGATSSGS FNMDSILAAG GKKNMGMASD RLAELALLDP  180
KRAKRILANR QSAARSKERK IKYTGELERK VQTLQNEATT LSAQVTMLQR GTSDLTTENK  240
HLKMRLQALE QQAELRDALN EALRGELNRL KIAAGEIPQG NGNSFNNNRA QFSSQLVGNN  300
NKNQQMSTNG QPSSFMDFTK RG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00184DAPTransfer from AT1G43700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR5374340.0KR537434.1 Brassica napus cultivar SLM046 VirE2-interacting protein 1 (VIP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013586120.10.0PREDICTED: transcription factor VIP1-like
SwissprotQ9MA751e-158VIP1_ARATH; Transcription factor VIP1
TrEMBLA0A0D3CFD40.0A0A0D3CFD4_BRAOL; Uncharacterized protein
STRINGBra032191.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79932639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.11e-146VIRE2-interacting protein 1